PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_24712_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 813aa    MW: 91725.6 Da    PI: 9.8105
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_24712_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA484.1e-156677081658
                   CBFB_NFYA  16 kRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 kRRq R+kle+++kl +k rkpy+heS h h l+R+ g+gG+F
  Cotton_A_24712_BGI-A2_v1.0 667 KRRQYREKLEAQNKL-IKVRKPYMHESQHLHSLKRAIGNGGQF 708
                                 8**************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF520581.46E-2137366IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.106.2E-1847131IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM0036956386IPR003591Leucine-rich repeat, typical subtype
SMARTSM0036914111134IPR003591Leucine-rich repeat, typical subtype
Gene3DG3DSA:3.80.10.106.2E-18205357IPR032675Leucine-rich repeat domain, L domain-like
PfamPF048526.1E-52496613IPR006936ALOG domain
PROSITE profilePS5169763.958500627IPR006936ALOG domain
SMARTSM005217.0E-16650711IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115220.302651711IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.9E-8654676IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.6E-11666708IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.9E-8685708IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MANLVANVGG LGFSKQPKKE LQWDAKAMDN KQSELQESSN SPSWIAMYLQ STCDLAAIPP  60
LFFHNLQVLD LSHTNIKALP HSLPNSFFAL KKLLLRRCKL FMELSPHVGK LDNLEELDLD  120
DTEIISIPIG IGKLMKFTVG HHKRRTISRV PDEVEAQFTK WDKCLKFVNG ENIPFQVRKV  180
LKFTSSFFLD RHENASSLSE FGNENMVMLK YCLLVDCNKM ETIIDGAEVE TVLESLQYLS  240
IHYMKNLISI WKGPSRFGFM SKLKFLALHT CPKLSNIFSQ VLLRNFVNLE EIIVEDCPQV  300
SSLVSHVHAL PSLKPFLPSL KRLFLLYLPE LVSIAPKLER IGFYDCPKLK VLSKSELSSK  360
ALKTIKAEKQ WWEGIKWNKI DWKTGPRYLM HIFSPINNEK DVMAQLLEDR NVFEAQQSDC  420
MVKSMPLKGL RIPSSMTLPC LTVTRRLNIQ VEHTRGFLKT SGQLSDLVNN PGYNEQKISS  480
VGGSNSKAII SGAMPSTPSR HQSKKHRDWK TFCQYLNNHK PPISVPMCNA AHVLEFLKYL  540
DQFGKTKVHI SACSFFGQSN PPGPCGCPLR QAWGSVDALV GRLSSSYEDL GGKPEVNPFR  600
AGVVRIYLRE VRDAQNKARG ISYKKRKKSE IKVANTTTTT TTTTTTTTTT TTTTTITNTN  660
ILRCQNKRRQ YREKLEAQNK LIKVRKPYMH ESQHLHSLKR AIGNGGQFLN TKKLQQSKST  720
PTSHGPDMSR SPQLHLFANI SETDVHQPKN FKDSGSATSC SDVRSASNSD EMLQQPDFGF  780
SSYPPDHTGE AMPCHAGNIH GDGNLHHHSS HFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1623627KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6163411e-126JX616341.1 Gossypium hirsutum clone NBRI_GE60921 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007010574.10.0Uncharacterized protein TCM_044482
TrEMBLA0A0D2VQH10.0A0A0D2VQH1_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM802034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.33e-29nuclear factor Y, subunit A3